KEGG   Adhaeretor mobilis: HG15A2_21140
Entry
HG15A2_21140      CDS       T07351                                 
Symbol
bioI
Name
(GenBank) Biotin biosynthesis cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
amob  Adhaeretor mobilis
Pathway
amob00780  Biotin metabolism
amob01100  Metabolic pathways
amob01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:amob00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HG15A2_21140 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:amob00199]
    HG15A2_21140 (bioI)
Enzymes [BR:amob01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     HG15A2_21140 (bioI)
Cytochrome P450 [BR:amob00199]
 Cytochrome P450, bacteria type
  CYP107 family
   HG15A2_21140 (bioI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: QDS98829
UniProt: A0A517MVC3
LinkDB
Position
2564983..2566368
AA seq 461 aa
MKKSPKQACTIQYIPESSAVYSAFYHLIVVQFEKCVPTEPKLKLSRKLDMLSNSKSIDDL
LLTPGYVESPYEVFDLLRTEAPVYWSEKWNGWVLTRYDDVLNVLKDFKRLSNGGRYTEYL
STLATDELAQLTYLQNHYERGGLVQADPPSHNRLRKLIGNAFTPRMVNEMGRLVSQISDD
LIDSFVGMPEVELIYNFAFALPATVIAGMLGVPIEQRDQFKDWSAAIQRFLGTGKVDFQS
ALEAQEAWRNMNDFFTQLLLDRTSHPQEDLISGFVQSYEEGERLTKEEIIGTCGAMLVAG
HETTTNLISNAIWLLLQDQEQLKQLKENPSLYPSAIEEFLRYESPFQCLPRTLREDVEID
GIRMRKGQLVYAMLGAANRDPCQFDNPEQLDLHRENNKHLAFGYGVHFCLGAPLARLEAH
IAIQTLLERLPQMQLDQNRPPDWKRSMVQRGMESFWLCIRS
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgaagaaatcgccgaagcaagcatgcacgattcagtacattcctgaatcctcagcagtc
tactcggcattctatcacttgattgttgttcaattcgagaagtgcgtacccacagaacca
aaactaaaactttcgagaaaattagacatgctgagcaattccaaatcaatagacgacctg
ctactcacacctgggtatgtggagtcgccctatgaagtcttcgacctattacgcactgag
gcgcccgtttactggagtgaaaagtggaacggctgggtgcttacccgctatgacgacgtg
ctcaacgtcctcaaggatttcaagcgtttgtccaatggcgggcgttacaccgagtacctc
tcaacactggcgactgacgagctcgcgcagctaacgtacctgcagaaccactacgaacga
ggcggactcgtccaagccgacccgcccagccacaacaggcttcgtaaactcattggcaat
gctttcactcctcgaatggtcaatgagatgggaagattggtcagccaaatttccgatgat
ctgatcgactcttttgttggaatgcccgaagtcgagttgatctataactttgcgttcgcc
ttacccgctacagtgatcgcagggatgttgggagtgccaatcgagcaacgcgatcaattc
aaagattggtcggcggcgatccagcgattcctaggtacagggaaagtagattttcaatct
gccttggaagcccaggaggcatggaggaatatgaatgattttttcacgcaacttctcctg
gaccgcacgtcgcacccgcaggaagatctgattagcggcttcgtccaatcttacgaggaa
ggcgaacgcctcaccaaagaggaaatcatcggcacctgcggcgcaatgctggtggctggg
catgagacgacgacaaatctcatctcaaatgcgatctggttgttactccaagaccaggag
caattgaagcaactcaaagagaatccttccctatatccctcagctatcgaagaatttttg
cgatacgaatctcctttccaatgcttacctcggacgctccgtgaggatgtcgaaattgat
ggcattcgaatgagaaaaggacaactcgtctacgctatgttaggcgcagcgaatcgggat
ccttgccaattcgataatcctgaacagctcgatcttcaccgcgagaacaataagcatctt
gctttcgggtatggcgtccatttttgccttggggctcccttggcgcggttggaagcccac
atcgcgatccaaactttgctcgaaaggctcccccagatgcagctagatcagaatcgaccg
cccgactggaaacgtagcatggttcaacgaggcatggagtcgttttggctctgtattcga
tcatag

DBGET integrated database retrieval system