Malaciobacter molluscorum: AMOL_0333 Help Entry AMOL_0333         CDS       T06655                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amol  Malaciobacter molluscorum Pathway amol01100   Metabolic pathways amol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMOL_0333 (acpP)    00074 Mycolic acid biosynthesis     AMOL_0333 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMOL_0333 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AXX91349 UniProt:  A0A2G1DK71 LinkDB All DBs Position complement(326272..326502) Genome browser AA seq 76 aa AA seqDB search MALLDDVKEVVVEQLDCDIAEIKEDSKFIEDLGADSLDVVELVMALEEKFDIEIPDEDAE GIQTVADAIKYIEEHA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcattattagatgatgtaaaagaagtagtagtagagcaactagattgtgatattgca gaaattaaagaagattctaaatttattgaggatttaggtgcagactctttagacgtagtt gaattagttatggctttagaagaaaaatttgatatcgaaatccctgatgaagatgctgaa ggtatccaaacagttgctgatgctatcaaatacatcgaagagcacgcataa

DBGET integrated database retrieval system