Paenacidovorax monticola: H9L24_07325
Help
Entry
H9L24_07325 CDS
T06798
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulator PhoB
KO
K07657
two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
amon
Paenacidovorax monticola
Pathway
amon02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
amon00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
H9L24_07325 (phoB)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
amon02022
]
H9L24_07325 (phoB)
Two-component system [BR:
amon02022
]
OmpR family
PhoR-PhoB (phosphate starvation response)
H9L24_07325 (phoB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Trans_reg_C
Response_reg
HTH_11
GerE
Motif
Other DBs
NCBI-ProteinID:
QNP60616
UniProt:
A0A7H0HJA0
LinkDB
All DBs
Position
complement(1542383..1543090)
Genome browser
AA seq
235 aa
AA seq
DB search
MKKLPRVLIVEDEPAIAELIAVNLRHNGFAPIWSEDGESAQRELDAVLPDVILLDWMLPG
QSGLQLARKWRADSRTKPIPILMLTARGDEPDKVAGLDAGADDYITKPFSTQELLARIRA
VLRRRAPEQVSDSVTIGELVLDAATYRVTFQGQQLKVGPTEFKLLHFLMKHSERVHSRSQ
LLDKVWGDHVFIEERTVDVHVKRLREALGTAGVMVETVRGAGYRLTGQPQALMQA
NT seq
708 nt
NT seq
+upstream
nt +downstream
nt
atgaaaaaactaccccgtgttctcatcgtcgaggatgaacccgcgatcgccgagctgatc
gccgtgaacctgcgccacaacggcttcgcgccgatctggtcggaggatggcgagtcggcg
cagcgcgagctcgatgccgtgctgcccgacgtgatcctgcttgactggatgctgccgggc
cagagcggcctgcaactggcgcgcaagtggcgcgcggacagccgcaccaagcccattccc
atcctcatgctcaccgcgcgcggcgacgagcccgacaaggtggcggggctggacgccggc
gccgacgactacattaccaagcccttctccacgcaggagctgctcgcgcgcatccgcgcc
gtgctgcgccgccgcgcgcccgagcaggtaagcgacagcgtgaccatcggcgagctggtg
ctcgacgccgccacctaccgcgtgaccttccagggccagcagctcaaggtggggcccacc
gagttcaagctgctgcacttcctcatgaagcactccgagcgcgtgcacagccgctcgcag
ctgcttgataaggtgtggggcgaccatgtcttcatcgaggagcgcacggtggacgtgcat
gtgaagcgcctgcgcgaggcgctgggcaccgccggcgtgatggtggagaccgtgcgcggc
gcgggctaccgcctcaccggtcagccccaggccctgatgcaggcctga
DBGET
integrated database retrieval system