Paenacidovorax monticola: H9L24_15410 Help Entry H9L24_15410       CDS       T06798                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amon  Paenacidovorax monticola Pathway amon01100   Metabolic pathways amon01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amon00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H9L24_15410    00074 Mycolic acid biosynthesis     H9L24_15410   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H9L24_15410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding HMUD2 Motif Other DBs NCBI-ProteinID:  QNP58407 UniProt:  A0A7H0HCZ1 LinkDB All DBs Position 3237860..3238138 Genome browser AA seq 92 aa AA seqDB search MNPDIYATLTGLLEQKFHLDPARLRPDVTLEELGLDSLSLMDFIFNAEDAYRLRIPEELL DPRQSGITLQHICEVIEGQLAAQPAPAHGAAA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaccccgacatctacgccaccctcaccgggctgctggagcagaagttccacctcgac cccgcccggctgcgccccgacgtcacgctcgaggagctgggcctggactcgctctcgctg atggacttcatcttcaacgccgaggacgcctaccgcctgcgcatccccgaggagctgctg gacccgcgccagagcggcatcacgctgcagcacatctgcgaagtgatcgaaggccagttg gccgcccagcccgcacccgcccacggagcggccgcgtga

DBGET integrated database retrieval system