Anopheles moucheti: 128305300 Help Entry 128305300         CDS       T09615                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism amou  Anopheles moucheti Pathway amou04013   MAPK signaling pathway - fly amou04145   Phagosome amou04148   Efferocytosis amou04310   Wnt signaling pathway amou04620   Toll-like receptor signaling pathway amou05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:amou00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     128305300    04310 Wnt signaling pathway     128305300  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     128305300    04148 Efferocytosis     128305300  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     128305300  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     128305300  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:amou04131]     128305300   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amou04147]     128305300    04031 GTP-binding proteins [BR:amou04031]     128305300 Membrane trafficking [BR:amou04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     128305300  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     128305300   Macropinocytosis    Ras GTPases     128305300  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     128305300 Exosome [BR:amou04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128305300   Exosomal proteins of other body fluids (saliva and urine)    128305300   Exosomal proteins of colorectal cancer cells    128305300   Exosomal proteins of bladder cancer cells    128305300 GTP-binding proteins [BR:amou04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     128305300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  128305300 NCBI-ProteinID:  XP_052898640 LinkDB All DBs Position 3:81713477..81724369 Genome browser AA seq 198 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNIPIILVGTKLDLR DDKNTVDKLRDKKLSPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPM IPPKKKPKCQPLWRLFSY NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgatcaaatgtgttgtcgtcggtgacggtgccgtcggtaagacgtgtctgctg atcagctacacaacgaacgcatttcccggcgagtacatcccgaccgtgttcgataactac tccgcgaacgtgatggtcgatggcaaaccgatcaatctcggcctctgggatacggccggt caggaggattacgatcgacttcggcctctgtcctacccacagacggacgtatttctcatc tgcttttcgctcgtgaatccggcctcgtttgagaacgtgcgggcgaaatggtacccggag gtgcgccaccattgtccgaacataccgatcatactggtcgggacgaagctcgatctgcgg gatgacaaaaacacggtggacaagctgcgtgacaagaagctgtcgccgatcacgtacccg caggggttggcaatggcgaaggagattggcgcggtcaagtacctcgagtgttccgcactg acgcagaagggcctgaagacggtgttcgatgaagcgatccgggcggtcctctgtccgatg ataccgccgaagaagaaacccaagtgccaaccattgtggcgtttgttttcgtactaa

DBGET integrated database retrieval system