Anaplasma marginale Gypsy Plains: U128_00020
Help
Entry
U128_00020 CDS
T02900
Name
(GenBank) rod shape-determining protein RodA
KO
K05837
peptidoglycan glycosyltransferase [EC:
2.4.99.28
]
Organism
amp
Anaplasma marginale Gypsy Plains
Pathway
amp00550
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:
amp00001
]
09100 Metabolism
09107 Glycan biosynthesis and metabolism
00550 Peptidoglycan biosynthesis
U128_00020
09180 Brite Hierarchies
09181 Protein families: metabolism
01003 Glycosyltransferases [BR:
amp01003
]
U128_00020
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
amp01011
]
U128_00020
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:
amp03036
]
U128_00020
Enzymes [BR:
amp01000
]
2. Transferases
2.4 Glycosyltransferases
2.4.99 Transferring other glycosyl groups
2.4.99.28 peptidoglycan glycosyltransferase
U128_00020
Glycosyltransferases [BR:
amp01003
]
Polysaccharide
Bacterial polysaccharide (excluding LPS)
U128_00020
Peptidoglycan biosynthesis and degradation proteins [BR:
amp01011
]
Peptidoglycan biosynthesis and degradation
Glycosyltransferase
U128_00020
Chromosome and associated proteins [BR:
amp03036
]
Prokaryotic type
Chromosome partitioning proteins
Other chromosome partitioning proteins
U128_00020
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
FTSW_RODA_SPOVE
Motif
Other DBs
NCBI-ProteinID:
AGZ78495
LinkDB
All DBs
Position
3323..4393
Genome browser
AA seq
356 aa
AA seq
DB search
MSKIRVLLLLDVAILLLVGFGIQYSSAGGHWHPFAKHHLYVCAVCIPLSIAASFVSVKSY
MRYSYLAYAGAFCLLLMVHVFGHSAMGATRWLKVGAFGAQPSEFAKVSLILALARYFHCR
NPHRSLSLRNFTGGMIITLPLVLSVSKQPNLGTAGIMLLMAMLMMFVAVADRRYMAWFLS
LLCAMSPIVWGMLHHYQKNRLLSFLDPGRDPMGMGYNSLQSQIAIGSGGMYGKGFANGSQ
TKLGFLPEKQTDFVFSVFSEEHGFVGVILLFALYSMLVYTSLYVALCARCNFSRLMAVGI
SVFFMLHLFINVGMVTGILPIVGIPLPFLSYGGSIMLTSMVLVGILAAVAREARTP
NT seq
1071 nt
NT seq
+upstream
nt +downstream
nt
atgtccaaaatacgcgttttactgttgctggatgtggctatactgctgctcgtcggtttt
ggaatccaatactcctccgctggcgggcactggcacccttttgccaagcaccacctgtac
gtttgcgcagtgtgcatacctctgtctattgcggcgtcatttgtcagtgtaaagtcgtat
atgaggtactcatacttggcgtacgccggcgcgttttgccttttgttgatggtacacgtt
tttgggcattcagccatgggtgcaaccaggtggctaaaggtgggtgcctttggcgcgcaa
ccatcggagtttgccaaggtctccctgatcctcgccttggcccgatattttcactgcaga
aacccacaccgatctctaagtttacgcaattttactggggggatgataatcaccctgccg
ctggtactttcagtgtctaagcaacccaacttgggtactgcgggtatcatgctcctcatg
gcgatgcttatgatgtttgttgctgttgccgataggcgatacatggcgtggtttttatct
ctgctgtgtgcaatgtctcccatagtgtggggcatgctgcaccattatcagaaaaacagg
ctgctgtccttcttagaccctgggcgtgaccctatgggtatggggtataattctttgcaa
tcacagatagccataggttccggtggaatgtacggcaagggctttgcgaacggtagccaa
accaaattgggtttcttacccgagaagcagaccgattttgttttttccgtttttagcgag
gagcacggatttgtgggcgtgattttgctgttcgccctgtacagcatgttggtatacacc
agcttatacgttgccttgtgtgcgcgctgcaacttcagtaggctaatggcggtggggatc
tctgtgtttttcatgctacacctcttcatcaatgtaggcatggtcaccggaattttgccc
atagttgggattccgctgccgtttctgtcatacggggggagcattatgcttacgagtatg
gtgcttgtgggcatacttgcagccgttgctcgggaggcccgtactccctaa
DBGET
integrated database retrieval system