Amycolatopsis methanolica: AMETH_5186 Help Entry AMETH_5186        CDS       T03230                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amq  Amycolatopsis methanolica Pathway amq01100   Metabolic pathways amq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMETH_5186 (acpP)    00074 Mycolic acid biosynthesis     AMETH_5186 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMETH_5186 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AIJ25278 UniProt:  A0A076MX20 LinkDB All DBs Position 5352545..5352790 Genome browser AA seq 81 aa AA seqDB search MADKQEILSGLAEIVEEVAGVAQDDVSLEKSFVDDLDIDSLSMVEIAVQAEDKFGVKIPD DELANLKTVGDAVDYVAANAK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt gtggcggacaagcaggagatcctcagcggcctcgcggagatcgtcgaggaggtcgcgggt gtcgcgcaggacgacgtgagcctggagaagtccttcgtcgacgacctggacatcgactcg ctgtcgatggtggagatcgcggtgcaggccgaggacaagttcggggtcaagattccggac gacgagctggccaacctgaagaccgtcggcgacgcggtggactacgtcgccgcgaacgcc aagtaa

DBGET integrated database retrieval system