Acaryochloris marina: AM1_5523 Help Entry AM1_5523          CDS       T00617                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amr  Acaryochloris marina Pathway amr01100   Metabolic pathways amr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AM1_5523 (acpP)    00074 Mycolic acid biosynthesis     AM1_5523 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AM1_5523 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 LTV Motif Other DBs NCBI-ProteinID:  ABW30477 UniProt:  B0CE03 LinkDB All DBs Position complement(5571221..5571466) Genome browser AA seq 81 aa AA seqDB search MSESEIFGKVKDIVAEQLSVDADKVTPEASFQNDLDADSLDVVEMVMALEEEFDIEIPDE AAEEILTVQAAVDFIAGKVKA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtgagtcggaaatttttggcaaagtaaaagatattgttgctgagcaattaagtgtt gatgcagacaaagtaacgccagaagcgagcttccagaacgatctagatgctgactccctg gatgttgtggaaatggtcatggctctagaagaagagtttgacatcgaaattccagacgaa gcagccgaagaaattcttacggttcaagctgccgttgactttatcgccggcaaagtaaag gcttag

DBGET integrated database retrieval system