Acaryochloris marina: AM1_D0163 Help Entry AM1_D0163         CDS       T00617                                  Symbol atpE Name (GenBank) ATP synthase C chain   KO K02110   F-type H+-transporting ATPase subunit c Organism amr  Acaryochloris marina Pathway amr00190   Oxidative phosphorylation amr00195   Photosynthesis amr01100   Metabolic pathways Module amr_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:amr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AM1_D0163 (atpE)    00195 Photosynthesis     AM1_D0163 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:amr00194]     AM1_D0163 (atpE) Photosynthesis proteins [BR:amr00194]  Photosystem and electron transport system   F-type ATPase [OT]    AM1_D0163 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C SecY BC10 Motif Other DBs NCBI-ProteinID:  ABW32658 UniProt:  A8ZNS2 LinkDB All DBs Position pREB4:128434..128721 Genome browser AA seq 95 aa AA seqDB search MDNIALVGMASIVISGLTIAIGSIGPALGEGRALSQALSALAQQPDEANTITRVLFVGMA LVESTAIYCFVITLILIFANPFWTYVVEQASTNGG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggataatattgcccttgtgggcatggcttcgattgtgatctctggactcaccattgcc attggctccatcggtccagccctaggggaaggtcgtgccttatcccaggcactaagcgcc ctggcgcaacaacctgatgaagccaataccatcaccagagtgctgtttgtggggatggca ttggtcgaatcaacggccatttactgttttgtgattacattgattctgatttttgccaat ccattttggacctatgtggtggagcaggccagcaccaatggaggataa

DBGET integrated database retrieval system