Anopheles marshallii: 128709723 Help Entry 128709723         CDS       T10928                                  Name (RefSeq) GTPase HRas   KO K07827   GTPase KRas Organism amrs  Anopheles marshallii Pathway amrs04013   MAPK signaling pathway - fly amrs04068   FoxO signaling pathway amrs04137   Mitophagy - animal amrs04140   Autophagy - animal amrs04150   mTOR signaling pathway amrs04213   Longevity regulating pathway - multiple species amrs04214   Apoptosis - fly amrs04320   Dorso-ventral axis formation amrs04519   Cadherin signaling Brite KEGG Orthology (KO) [BR:amrs00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     128709723    04068 FoxO signaling pathway     128709723    04150 mTOR signaling pathway     128709723   09133 Signaling molecules and interaction    04519 Cadherin signaling     128709723  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128709723    04137 Mitophagy - animal     128709723   09143 Cell growth and death    04214 Apoptosis - fly     128709723  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     128709723   09149 Aging    04213 Longevity regulating pathway - multiple species     128709723  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:amrs04131]     128709723   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:amrs04031]     128709723 Membrane trafficking [BR:amrs04131]  Endocytosis   Macropinocytosis    Ras GTPases     128709723 GTP-binding proteins [BR:amrs04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     128709723 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Motif Other DBs NCBI-GeneID:  128709723 NCBI-ProteinID:  XP_053660707 LinkDB All DBs Position 2:complement(46401714..46403512) Genome browser AA seq 190 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL QAWAVDMNQARDVAKQYGVPFVETSAKTRMGVDDAFYTLVREIRKDKERGKKNRKHHKLV SSRRFKCQLL NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataaactagtagtagtaggcgctgggggtgtcggcaagtcggcgcttacc atacaacttattcagaaccatttcgtggatgagtacgatccaacaattgaagattcctac cggaagcaagtagttatagatggtgaaacgtgtttgctcgatattctggatacagccgga caggaggagtactcggcgatgcgtgatcagtatatgcgaacgggtgaaggatttctttta gtatttgctgttaacagtgccaaaagtttcgaagatataggaacctaccgagaacagatt aagcgtgttaaagacgcagaagaagtgccaatggtgttagttggcaacaagtgcgatctg caagcatgggcagttgatatgaaccaggccagagacgtggcgaaacagtacggtgttcct tttgtagaaacttcggccaaaacacggatgggcgtggacgatgcattctatacgctagtg cgtgaaattcgcaaagacaaagagagggggaagaagaaccgaaagcaccacaaactggtg tctagcagacgattcaagtgccagttgctataa

DBGET integrated database retrieval system