Anopheles marshallii: 128719690 Help Entry 128719690         CDS       T10928                                  Name (RefSeq) LIRP-like   KO K04526   insulin Organism amrs  Anopheles marshallii Pathway amrs04068   FoxO signaling pathway amrs04081   Hormone signaling amrs04140   Autophagy - animal amrs04150   mTOR signaling pathway amrs04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:amrs00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     128719690    04150 mTOR signaling pathway     128719690   09133 Signaling molecules and interaction    04081 Hormone signaling     128719690  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128719690  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     128719690  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:amrs04052]     128719690 Cytokines and neuropeptides [BR:amrs04052]  Neuropeptides   Unclassified    128719690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Toxin_32 Motif Other DBs NCBI-GeneID:  128719690 NCBI-ProteinID:  XP_053669293 LinkDB All DBs Position 2:63431589..63432063 Genome browser AA seq 133 aa AA seqDB search MRSIFVGMNSILIVAVVVLLLLNESKANSTPNSDALISQLTRSRYCGRRLTETLAFLCQG RYPMLTHYRTDYVHDQQNQRVKVEVATLPDTLPPGFPYPGAGVHRRSRRNSGGIYDECCK KSCSYVELRAYCD NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgcgatctatctttgtcggaatgaactccatcctgatcgtagcggtggttgtgctgttg ctgctgaacgaaagtaaagccaactccacgccgaacagcgatgccttgatcagtcagtta actcgctcacgctattgtggccgtcggcttacagagacgcttgccttcctctgccaggga cggtatccgatgctaacgcattatcgaaccgactacgtccacgatcagcaaaaccagcga gtaaaggtagaagtagccacgctgcctgatacactaccaccgggcttcccgtatcctggg gctggtgtgcaccggcgtagtcggcgcaattccggcggcatttacgatgagtgctgcaag aagagctgctcgtacgtcgagctgcgtgcgtactgtgattga

DBGET integrated database retrieval system