Anopheles marshallii: 128719743 Help Entry 128719743         CDS       T10928                                  Name (RefSeq) dynein light chain Tctex-type   KO K10420   dynein light chain Tctex-type 1/3 Organism amrs  Anopheles marshallii Pathway amrs04814   Motor proteins Brite KEGG Orthology (KO) [BR:amrs00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     128719743  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:amrs03037]     128719743    04812 Cytoskeleton proteins [BR:amrs04812]     128719743 Cilium and associated proteins [BR:amrs03037]  Motile cilia and associated proteins   Dynein arm    128719743 Cytoskeleton proteins [BR:amrs04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      128719743 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  128719743 NCBI-ProteinID:  XP_053669348 LinkDB All DBs Position 2:11089256..11092834 Genome browser AA seq 111 aa AA seqDB search MEDGKEEHQFVVDDVSKIIKEAIETTIGGNAYQHDKVNNWTGSVVENCLSVLTKLQKPYK YIVTCMIMQKNGAGLHTASSCYWNNETDGSCTVRWENKTMYCIVSVFGLSI NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggaggatggcaaagaagagcaccagttcgttgtggacgatgtaagtaagataatcaag gaagcgatcgagacgacgattggaggcaatgcttatcagcatgacaaagtcaacaactgg accggatctgttgtcgagaactgccttagcgtgttaactaagctacagaagccttacaag tacatcgtaacgtgcatgataatgcagaaaaatggcgctgggctgcatacggcaagttct tgctactggaataacgaaaccgatggttcttgcacagtgcgctgggagaataagacgatg tactgcatcgtatcggtgttcggactttcgatctaa

DBGET integrated database retrieval system