Actinoplanes missouriensis: AMIS_13080 Help Entry AMIS_13080        CDS       T01795                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism ams  Actinoplanes missouriensis Pathway ams00998   Biosynthesis of various antibiotics ams01100   Metabolic pathways ams01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ams00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMIS_13080    00074 Mycolic acid biosynthesis     AMIS_13080   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMIS_13080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BAL86528 UniProt:  I0H0J1 LinkDB All DBs Position complement(1392933..1393175) Genome browser AA seq 80 aa AA seqDB search MATREEITSGLAEILEEVAGVNPDDVAEGKSFTDDLDVDSLSMVEVVVAAEEKFGVKIPD NEVQNLKTVGDAVTYIEANH NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcaactcgcgaagagatcacctccggcctcgccgagatcctcgaggaggtcgccggg gtgaacccggacgacgtcgccgagggtaagtccttcaccgacgacctggacgtcgactcg ctgtccatggtcgaggtcgtcgttgcggccgaggagaagttcggcgtcaagatccccgac aacgaggtccagaacctcaagaccgtcggcgatgccgtcacctacatcgaggcaaaccac tga

DBGET integrated database retrieval system