Alkaliphilus metalliredigens: Amet_1223 Help Entry Amet_1223         CDS       T00551                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amt  Alkaliphilus metalliredigens Pathway amt01100   Metabolic pathways amt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Amet_1223    00074 Mycolic acid biosynthesis     Amet_1223   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Amet_1223 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7127 Motif Other DBs NCBI-ProteinID:  ABR47431 UniProt:  A6TML3 LinkDB All DBs Position complement(1270185..1270415) Genome browser AA seq 76 aa AA seqDB search MLFEKIRDLVAEQLGVDDASIITLSTSLLNDLDADSLDAVEIIMAIEDEFGLEIPDEEAE GFKNIGNIVEYVEAHK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgttatttgaaaaaatcagagatttagttgccgagcaattaggagtcgatgatgccagt atcattacactatctacatcattattaaatgatttagatgcagattctcttgatgctgtt gaaatcatcatggccattgaggatgagttcggactagaaattcccgacgaagaagctgaa ggctttaaaaacatcggaaatatcgttgagtatgttgaagcacataaataa

DBGET integrated database retrieval system