Akkermansia muciniphila: Amuc_0975 Help Entry Amuc_0975         CDS       T00736                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amu  Akkermansia muciniphila Pathway amu01100   Metabolic pathways amu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Amuc_0975    00074 Mycolic acid biosynthesis     Amuc_0975   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Amuc_0975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  ACD04807 UniProt:  B2UQS2 LinkDB All DBs Position 1165539..1165781 Genome browser AA seq 80 aa AA seqDB search MSDNSIEEKVRSIIVDQLGVESDKVTADAKFIEDLGADSLDTVELVMAFEENFDIEVPDE EAEKLQSVADVVAYIEKVQG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaacagcatcgaagaaaaagtaagaagtatcatcgtcgaccaacttggcgtt gaatccgataaagtgactgctgatgcgaaattcatcgaggatctcggtgctgattcgctg gataccgttgaactcgtgatggctttcgaagaaaactttgacatcgaagtgcccgacgaa gaagccgaaaagcttcagtctgttgccgacgtcgttgcttacatcgaaaaggttcagggt taa

DBGET integrated database retrieval system