Acropora muricata (staghorn coral): 136912245 Help Entry 136912245         CDS       T11512                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism amua  Acropora muricata (staghorn coral) Pathway amua04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:amua00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     136912245  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:amua04121]     136912245    03400 DNA repair and recombination proteins [BR:amua03400]     136912245 Ubiquitin system [BR:amua04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      136912245    Cul5 complex      136912245 DNA repair and recombination proteins [BR:amua03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      136912245 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  136912245 NCBI-ProteinID:  XP_067034636 LinkDB All DBs Position 3:complement(23382468..23386517) Genome browser AA seq 123 aa AA seqDB search MTDSDDKKVLDEPQTEPVYGSCEGPTAMYVKLISSDDHEFIINRDYALTSGTIKAMLSGP GQFSENETNEVNFREIPSHVLAKVCTYFMYKVRYTNSSTEIPEFPIAPEIALELLMAANF LDC NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgacagactctgatgacaagaaagtattagatgaaccccagacagagccagtatatggc agctgtgaaggacccaccgccatgtatgtcaagctgatttccagtgacgatcacgagttc ataattaatagagattatgcattgacatcagggacaatcaaagctatgttaagtggacca ggccagttttcagagaacgagaccaatgaagttaatttcagagaaattccttctcatgtg ttggctaaagtgtgtacttacttcatgtacaaagtgcgatacacgaacagcagcacagag atcccagagttccccattgctccagagattgcccttgagctgttgatggcagccaatttc ctggattgctga

DBGET integrated database retrieval system