Aeoliella mucimassa: Pan181_21840 Help Entry Pan181_21840      CDS       T06952                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism amuc  Aeoliella mucimassa Pathway amuc02020   Two-component system amuc02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:amuc00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Pan181_21840  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Pan181_21840  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:amuc02035]     Pan181_21840 Bacterial motility proteins [BR:amuc02035]  Flagellar system   Flagellar assembly proteins    Others     Pan181_21840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  QDU55982 UniProt:  A0A518AMM8 LinkDB All DBs Position 2588330..2588638 Genome browser AA seq 102 aa AA seqDB search MHFGRGKSLIMQINGAHQVHGTQALNGPHFNQRPQQAEARTSSQPVDQLDISPAAQAASE STGTDGIRNDVVARLRAEIASGTYETPEKLEAAVDRLFDSMG NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgcactttggccgcgggaaatcactcatcatgcaaatcaacggcgcacaccaagttcac ggcactcaagccctcaacggaccccacttcaatcaacgccctcagcaggccgaggctcgc acctcgagccagccggtcgaccagctcgatatttcgccagccgcgcaagctgctagtgag agcaccggcaccgatggcattcgcaacgacgtggtggctcgcctgcgagcggaaattgcc agtggaacctacgaaactcctgaaaagctcgaagcagccgtcgatcggctgttcgactcc atgggctaa

DBGET integrated database retrieval system