Aeoliella mucimassa: Pan181_44790
Help
Entry
Pan181_44790 CDS
T06952
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
amuc
Aeoliella mucimassa
Pathway
amuc03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
amuc00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
Pan181_44790 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
amuc03011
]
Pan181_44790 (rplR)
Ribosome [BR:
amuc03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
Pan181_44790 (rplR)
Bacteria
Pan181_44790 (rplR)
Archaea
Pan181_44790 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID:
QDU58246
UniProt:
A0A518AU69
LinkDB
All DBs
Position
5441614..5441865
Genome browser
AA seq
83 aa
AA seq
DB search
MSAQLIDDIAGKTLASASTLDKGLSGDVKYGGNKDAAALVGKALAERAKQAGIETVCFDR
GAYKYHGRVAALADAAREGGLQF
NT seq
252 nt
NT seq
+upstream
nt +downstream
nt
atgtcggctcagttgatcgacgacatcgctggcaagacacttgccagtgcttcgacgctc
gataaaggtctgtccggcgatgtaaaatacggcggcaacaaagatgcggctgctctggtc
ggcaaggcccttgccgaacgcgccaagcaagcgggtatcgaaacggtttgcttcgaccgt
ggtgcttacaagtaccatggccgggtagcagctctggccgatgccgctcgtgaaggtggt
ttgcagttttag
DBGET
integrated database retrieval system