Achromobacter mucicolens: PE062_06230 Help Entry PE062_06230       CDS       T08808                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amui  Achromobacter mucicolens Pathway amui01100   Metabolic pathways amui01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amui00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PE062_06230    00074 Mycolic acid biosynthesis     PE062_06230   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PE062_06230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Motif Other DBs NCBI-ProteinID:  WBX90227 LinkDB All DBs Position complement(1361996..1362250) Genome browser AA seq 84 aa AA seqDB search MHTRDEIFNTLRGALVELFEIEPERITPDAHLYTDLEIDSIDAIDLIDHVRRQTGRKLDA NDFRTVRTVEDVVQAMWQKQDPAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcacacccgcgacgaaatcttcaacacgctgcgcggcgccctcgtcgaactgttcgaa atcgaaccggaacggatcacgcccgacgcgcatttgtacaccgatctggaaatcgacagc atcgacgcgatcgacctgatcgaccacgtgcgacgccagaccggccgcaagctggacgcc aacgacttccgcacggtccgcaccgtcgaagacgtcgtgcaggccatgtggcaaaagcag gaccccgccgcatga

DBGET integrated database retrieval system