Acutalibacter muris: ADH66_04495 Help Entry ADH66_04495       CDS       T09764                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amur  Acutalibacter muris Pathway amur01100   Metabolic pathways amur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ADH66_04495    00074 Mycolic acid biosynthesis     ADH66_04495   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ADH66_04495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1493 Ribosomal_L50 DUF1409 Motif Other DBs NCBI-ProteinID:  ASB39979 UniProt:  A0A1Z2XNF9 LinkDB All DBs Position complement(891708..891941) Genome browser AA seq 77 aa AA seqDB search MVLEKIKAILSEQFSVEEKEITVDTLLEDDLGADSLDVVDLLMTIEDDFEVEIPDEEVEN IKTVGALVEYIESHSQD NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggtactggaaaaaatcaaggccatactcagtgagcagttcagcgtggaggagaaggag ataaccgtggacaccctgttggaggacgacctgggcgcggactccctggacgtggtggac ctgctgatgaccatcgaggacgactttgaggtggagatccccgacgaggaggtcgagaac atcaagaccgtcggcgcactggtggagtacatcgagagccactctcaggattga

DBGET integrated database retrieval system