Akanthomyces muscarius: LMH87_005467 Help Entry LMH87_005467      CDS       T09501                                  Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism amus  Akanthomyces muscarius Pathway amus03060   Protein export amus04141   Protein processing in endoplasmic reticulum amus04145   Phagosome Brite KEGG Orthology (KO) [BR:amus00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     LMH87_005467    04141 Protein processing in endoplasmic reticulum     LMH87_005467  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     LMH87_005467  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:amus04131]     LMH87_005467   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:amus02044]     LMH87_005467 Membrane trafficking [BR:amus04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     LMH87_005467 Secretion system [BR:amus02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    LMH87_005467 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  80892626 NCBI-ProteinID:  XP_056058674 UniProt:  A0A9W8QNV2 LinkDB All DBs Position 1:1537498..1538299 Genome browser AA seq 110 aa AA seqDB search MSSPRASSPEGAATGASLNRPSSPTPPGGPRTAIRRRAAADQKEKIANARPSSTRSAGAG GSSSTMLRLYTDESPGLKVDPVVVLVLSLVFIFSVVALHIIAKITRKFSS NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgtcttctcctcgtgcttcctcgcccgaaggcgctgccactggcgccagcctcaaccgt ccctcgtcgcccacgccccctggcggtccccgaacggccattcgtcgccgcgccgctgcc gaccagaaggagaagattgccaatgcccgtcccagcagcacgcgctcggccggcgctggc ggctccagcagcaccatgctgagactctacactgatgagtctcccggtctcaaggtcgac cccgtcgttgttctcgttctctctcttgtcttcatcttcagcgttgttgctcttcacatt attgccaagattacccgaaaattctcgagctaa

DBGET integrated database retrieval system