Akanthomyces muscarius: LMH87_006069 Help Entry LMH87_006069      CDS       T09501                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism amus  Akanthomyces muscarius Pathway amus03020   RNA polymerase amus03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:amus00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     LMH87_006069   09124 Replication and repair    03420 Nucleotide excision repair     LMH87_006069  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:amus03021]     LMH87_006069    03400 DNA repair and recombination proteins [BR:amus03400]     LMH87_006069 Transcription machinery [BR:amus03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      LMH87_006069   RNA polymerase III system    RNA polymerase III      LMH87_006069   RNA polymerase I system    RNA polymerase I      LMH87_006069 DNA repair and recombination proteins [BR:amus03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       LMH87_006069 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  80893228 NCBI-ProteinID:  XP_056059308 LinkDB All DBs Position 1:3217202..3217615 Genome browser AA seq 79 aa AA seqDB search MIIPIRCFSCGKVTGDLWERYLQLIADPKKTDGDAMDELGLKRYCCRRMIMTHVDLIEKL LKYTPDGRSEIKQKLNEMA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgattatccctattcgttgcttctcctgcggcaaggtcactggcgacctctgggagcgc tacctgcagctcattgccgaccccaaaaagactgacggtgatgccatggacgagcttgga ctgaagcgctattgctgccgccgcatgatcatgacccacgttgacctgatcgagaagctc ctcaaatatacccccgatggacgaagcgagattaagcagaagctcaacgaaatggcataa

DBGET integrated database retrieval system