Acidiphilium multivorum: ACMV_08940 Help Entry ACMV_08940        CDS       T01446                                  Symbol soxD Name (GenBank) sarcosine oxidase delta subunit   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism amv  Acidiphilium multivorum Pathway amv00260   Glycine, serine and threonine metabolism amv01100   Metabolic pathways Module amv_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:amv00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     ACMV_08940 (soxD) Enzymes [BR:amv01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      ACMV_08940 (soxD)     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      ACMV_08940 (soxD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Lar_restr_allev Motif Other DBs NCBI-ProteinID:  BAJ80241 UniProt:  F0J5J2 LinkDB All DBs Position complement(1023544..1023798) Genome browser AA seq 84 aa AA seqDB search MLLIPCPHCGDRPEIEFAYGGEAHRVRAADPRAVDDAGWTDYLYIRRNARGDFEERWRHA HGCGRFFNLRRNTYTDMIDRGAAR NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgctgctgatcccctgcccgcattgcggcgaccgtccggaaatcgagttcgcctatggc ggcgaggcccaccgcgtccgcgccgccgacccgcgcgccgtcgatgacgcgggctggacc gactatctctacatccgccgcaacgcccgcggcgatttcgaggaacgctggcgccacgcc catggctgcggccgcttcttcaacctccgccgcaacacctacaccgacatgatcgaccgc ggagccgcacgatga

DBGET integrated database retrieval system