KEGG   Pelagerythrobacter marensis: AM2010_1558
Entry
AM2010_1558       CDS       T03951                                 
Name
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
amx  Pelagerythrobacter marensis
Brite
KEGG Orthology (KO) [BR:amx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:amx03016]
    AM2010_1558
Enzymes [BR:amx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     AM2010_1558
Transfer RNA biogenesis [BR:amx03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    AM2010_1558
 Prokaryotic type
    AM2010_1558
SSDB
Motif
Pfam: TruB_N TruB_C_2
Other DBs
NCBI-ProteinID: AKM07628
UniProt: A0A0G3XBA1
LinkDB
Position
complement(1629921..1630925)
AA seq 334 aa
MADPVNRHPASGWLILDKPRGLGSTQAVGAVKRNLREGGYPKTKVGHGGTLDPLAEGVLP
IALGEATKLAGRLLDASKIYEFTIAFGEETDTLDVEGEVIERSDRRPPIAAVAAILEHFT
GEIEQVPPAYSAVKIDGRRAYDRARSGEAVEMKTRAVTIHALSLASEREDAAPRSAFAAQ
AGRPDPFDPRAPLELADSITLVAHVSKGTYIRSLARDIARALGTVGHVTYLRRVKAGPFA
QEQAISLDKLNEIGKGARLEDLLLPLETGLDGIPAHDLDPESKQAVRQGRVLSGLPHPDG
LLLAKSGDVPVALMEVTAGTAKVVRGFNIPDTAE
NT seq 1005 nt   +upstreamnt  +downstreamnt
gtggctgatccggtgaacaggcaccccgcctcgggctggctcatcctcgacaagccgcgc
ggtctcggctcgacgcaggcggtcggcgcggtcaagcgcaacttgcgcgagggcggctat
cccaaaaccaaggtcgggcacggcggcacgctcgatccgctggccgaaggcgtgctgccg
atcgcgctgggggaggcgaccaagctggccgggcgattgctcgatgccagcaagatctat
gaattcacgatcgctttcggggaagagaccgatacgctcgacgtcgaaggcgaggtgatc
gaacgttcggaccgtcgcccgccgatcgccgcggtggcggcgatcctcgaacatttcacc
ggcgagatcgaacaggttccgcctgcctattcggcggtgaagattgacggtcggcgcgct
tatgaccgggcacggtcgggcgaggcggtggaaatgaagacgcgcgccgtcacgatccac
gcgctgtcgctggcgagcgagcgcgaggacgccgcgccgcgttccgccttcgccgcgcag
gccgggcgccccgaccccttcgacccgcgcgctccgctggaactggccgacagtatcacg
ctggtcgctcacgtatcgaagggcacctatatccgcagccttgcacgggatatcgcacgc
gcgcttggcacggtcggccacgtgacgtacctgaggcgggtgaaggccggtccgttcgcg
caggaacaggcgatttcgctggacaagctgaacgaaatcggtaagggcgcgcggcttgaa
gaccttctcctgccgttggagacggggctggacggtatcccggcccacgatctcgacccg
gaaagcaagcaggcggtccgccagggccgggtcctttccggattgccccatcccgacggg
cttcttctcgcgaaatccggcgatgtgccggtcgcgctgatggaagtgacggcggggacg
gcgaaagtcgtccggggtttcaatatccccgataccgcggagtga

DBGET integrated database retrieval system