Pelagerythrobacter marensis: AM2010_768 Help Entry AM2010_768        CDS       T03951                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism amx  Pelagerythrobacter marensis Pathway amx01100   Metabolic pathways amx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AM2010_768    00074 Mycolic acid biosynthesis     AM2010_768   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AM2010_768 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 DUF5783 TerB_C Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AKM06848 UniProt:  A0A0G3X8X8 LinkDB All DBs Position 794412..794648 Genome browser AA seq 78 aa AA seqDB search MSDTADRVQKIVVEHLGVEADKVTQDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVGDATKYIEEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgccgaccgcgtgcagaagatcgttgtcgagcatctgggcgtcgaagcc gacaaggtcacgcaggatgcgagcttcatcgatgacctgggcgctgacagcctcgacatc gtcgagctggtaatggcattcgaagaagaattcggggtcgagatcccggacgatgcggcc gaaaagatcaccactgtcggcgacgcgacgaagtacatcgaagaacacaaaggctaa

DBGET integrated database retrieval system