KEGG   Pelagerythrobacter marensis: AM2010_940
Entry
AM2010_940        CDS       T03951                                 
Name
(GenBank) TfdC2
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
amx  Pelagerythrobacter marensis
Pathway
amx00361  Chlorocyclohexane and chlorobenzene degradation
amx01100  Metabolic pathways
amx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amx00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    AM2010_940
Enzymes [BR:amx01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     AM2010_940
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg Big_1
Other DBs
NCBI-ProteinID: AKM07017
UniProt: A0A0G3X752
LinkDB
Position
983480..984262
AA seq 260 aa
MAHNRLDQIVGTIVESVRDAVKSQDITFEEYRAAIGYMMKISESGELPLLIDVFLNAAIV
DVINKNAHPSASPSDMEGPYFLDNAPVVSDGRIKTLDQYQGDQPMIVRGTVRDIDGAPLG
GVLVDMWSSTPDGKYGGIHDGVPVDFYRGKLKTDADGRFEFRSTVPVAYRIPDSGPTGAL
LEMMGRHSWRPAHVHLKVRSEGYRELTTQLYFEECPYVRSDCCEGIIPSEFVYPEIVENG
ARILEADLVIEPDRSARAAA
NT seq 783 nt   +upstreamnt  +downstreamnt
atggctcataatcgcctcgatcagatcgtcggcacgatcgtggaatcggtccgcgacgca
gtaaagtctcaggatatcacgttcgaggaataccgtgccgcaattgggtatatgatgaag
atttcggaaagcggcgaattgccccttctcatcgatgtcttcctgaatgctgcgatcgtg
gacgtaatcaacaagaacgcgcacccttctgcatcaccgtcggatatggaagggccctat
tttctcgataatgcgccggtcgtttccgatggccgcatcaagacgctcgatcagtaccag
ggcgatcagccgatgatcgtgcgcgggactgtacgcgatatagacggcgcgccgcttggc
ggcgtgctggtcgatatgtggagttccacgccggacggcaaatacggtggaatacacgac
ggtgtgccagtcgacttctatcgcggcaaactaaaaaccgatgcagacggcaggtttgaa
tttcgcagcaccgtgccggtcgcgtaccgtatccccgacagtggccctaccggcgcattg
ctggagatgatggggcgccatagctggcggccggcccatgtgcacctcaaagtgcgaagc
gaaggatatcgggagctgacgacccagctatatttcgaagaatgtccttacgtccgttcg
gactgttgcgaaggcatcatccccagcgagttcgtctaccccgagattgtcgagaacggc
gcccgtattctcgaggccgaccttgtgatcgagcccgacagatcggcgcgagctgccgcc
tga

DBGET integrated database retrieval system