Amycolatopsis sp. BJA-103: BKN51_07540 Help Entry BKN51_07540       CDS       T05296                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amyb  Amycolatopsis sp. BJA-103 Pathway amyb00998   Biosynthesis of various antibiotics amyb01100   Metabolic pathways amyb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amyb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BKN51_07540    00074 Mycolic acid biosynthesis     BKN51_07540   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BKN51_07540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AUI58088 LinkDB All DBs Position 1705448..1705747 Genome browser AA seq 99 aa AA seqDB search MTTETVPAETVLADIAVMLRELLEEYGLDDADIGRDTKFHDDLELESIDLVTLSGRLRDH YGDKVNFAEFIAERELDEIIALTVGELVDHVVASLAGRA NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaccactgaaaccgtgccggccgagacggtcttggccgacatcgccgtgatgctgcgt gaactgctcgaggaatacgggctggacgacgcggacatcggccgggacacgaagttccac gacgacctcgaactggagagcatcgacctcgtcacgctgtccggcaggctgcgggaccac tacggcgacaaggtcaacttcgccgagttcatcgccgaacgcgaactggacgagatcatc gcgctgaccgtgggcgaactggtcgaccacgtggtcgcgtccctggccgggagggcttga

DBGET integrated database retrieval system