Amycolatopsis sp. DSM 110486: K1T34_16840 Help Entry K1T34_16840       CDS       T10626                                  Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism amyd  Amycolatopsis sp. DSM 110486 Brite KEGG Orthology (KO) [BR:amyd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:amyd03110]     K1T34_16840    03029 Mitochondrial biogenesis [BR:amyd03029]     K1T34_16840 Chaperones and folding catalysts [BR:amyd03110]  Heat shock proteins   HSP10    K1T34_16840 Mitochondrial biogenesis [BR:amyd03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     K1T34_16840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 ADH_N DUF2635 FAA_hydrolase Motif Other DBs NCBI-ProteinID:  QYN26017 LinkDB All DBs Position 3480210..3480503 Genome browser AA seq 97 aa AA seqDB search MLQDRVLVRLSPEEGERRSSGGIVIPATAQVARRLAWGDVLGVGNSVRNVKQGDRVLFNP EDQLEVEIQGEGHFVLRERDVHAVATERTEHGTGLYL NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctgcaggaccgcgtgctcgtgcgcctgtcgccggaggagggcgaacgccgcagcagc ggcggaatcgtgatccccgcgaccgcgcaggtggcccgcaggctcgcctggggtgatgta ctgggcgtcggcaacagcgtgcgcaacgtcaagcagggcgatcgcgtgctcttcaacccg gaggaccagctcgaggtcgagatccagggtgagggccatttcgtgctgcgcgagcgggat gtccacgccgtcgccaccgagcggaccgaacacggcacggggctctacctgtag

DBGET integrated database retrieval system