Amycolatopsis sp. DSM 110486: K1T34_28675 Help Entry K1T34_28675       CDS       T10626                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amyd  Amycolatopsis sp. DSM 110486 Pathway amyd00998   Biosynthesis of various antibiotics amyd01100   Metabolic pathways amyd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amyd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K1T34_28675    00074 Mycolic acid biosynthesis     K1T34_28675   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K1T34_28675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  QYN16827 LinkDB All DBs Position complement(5900817..5901062) Genome browser AA seq 81 aa AA seqDB search MADNAEILAGLAEIVEEVAGVAQDDVTAEKSFVDDLDIDSLSMVEIAVQAEDKFGVKIPD DELANLKTVGDAMNYVSANSK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctgacaacgctgagatcctcgccggcctcgccgagatcgtcgaagaggtggccggt gtggctcaggacgacgtcaccgccgagaagtcgttcgtggacgacctggacatcgactcg ctgtcgatggtcgagatcgccgtgcaggccgaggacaagttcggcgtcaagatcccggac gacgagctcgccaacctgaagaccgtcggcgacgcgatgaactacgtgtccgccaactcg aagtaa

DBGET integrated database retrieval system