Amycolatopsis sp. EV170708-02-1: MJQ72_28315 Help Entry MJQ72_28315       CDS       T10873                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amye  Amycolatopsis sp. EV170708-02-1 Pathway amye00998   Biosynthesis of various antibiotics amye01100   Metabolic pathways amye01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amye00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MJQ72_28315    00074 Mycolic acid biosynthesis     MJQ72_28315   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MJQ72_28315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  UMP00382 LinkDB All DBs Position 6261597..6261842 Genome browser AA seq 81 aa AA seqDB search MADNAEILAGLAEIVEEVAGVAQDDVTAEKSFVDDLDIDSLSMVEIAVQAEDKFGVKIPD DELANLKTVGDAVNYVSANSK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt gtggcagacaacgcagagatcctcgccggcctcgccgagatcgtcgaagaggtcgccggt gtggcgcaggacgacgtgaccgccgagaagtccttcgtggacgacctcgacatcgactcg ctgtccatggtggagatcgctgtccaggccgaggacaagttcggcgtcaagatcccggac gacgagctggcgaacctgaagaccgttggcgacgcggtgaactacgtgtcggccaactcc aagtaa

DBGET integrated database retrieval system