Malaciobacter mytili: AMYT_0548 Help Entry AMYT_0548         CDS       T05895                                  Symbol groES Name (GenBank) 10 kD chaperonin (cpn10)   KO K04078   chaperonin GroES Organism amyt  Malaciobacter mytili Brite KEGG Orthology (KO) [BR:amyt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:amyt03110]     AMYT_0548 (groES)    03029 Mitochondrial biogenesis [BR:amyt03029]     AMYT_0548 (groES) Chaperones and folding catalysts [BR:amyt03110]  Heat shock proteins   HSP10    AMYT_0548 (groES) Mitochondrial biogenesis [BR:amyt03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     AMYT_0548 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 ADH_N DUF7205 PGM_PMM_III DUF4075 Motif Other DBs NCBI-ProteinID:  AXH14155 UniProt:  A0AAX2AG97 LinkDB All DBs Position 535646..535903 Genome browser AA seq 85 aa AA seqDB search MNFKPLGERVLVKRTEVENKTASGIYIPDNAKEKPHTAVVKAVGSKVEDVKVGDTVVFEQ YRGTEFTLEGEEYLVLNLENIIGVM NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaattttaaaccattaggggaaagagttcttgtgaaaagaactgaagttgaaaataaa acagcaagtggaatttatattcctgataatgcaaaagaaaaacctcatactgcagttgta aaagcagttggttcaaaagttgaagatgttaaagttggagacactgtagtatttgagcaa tatagaggtactgaatttactcttgagggtgaagaatatttagtattaaatcttgaaaat attattggagtaatgtaa

DBGET integrated database retrieval system