Amycolatopsis sp. YIM 10: YIM_25705 Help Entry YIM_25705         CDS       T06270                                  Symbol acpP2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism amyy  Amycolatopsis sp. YIM 10 Pathway amyy00998   Biosynthesis of various antibiotics amyy01100   Metabolic pathways amyy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amyy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     YIM_25705 (acpP2)    00074 Mycolic acid biosynthesis     YIM_25705 (acpP2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     YIM_25705 (acpP2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  QFU90317 LinkDB All DBs Position complement(5367035..5367361) Genome browser AA seq 108 aa AA seqDB search MTGTDSTNSAEIAERKAVIKELACEAFEIEPDELAEHTLFDEDLGIDSLSAIDLLAALEK RFGVEIDQVDLSQLTSLATVYEFIAGELGWTGGGVAAGQPVSGVVSGA NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgaccggcaccgacagcaccaacagcgccgagatcgccgagcgcaaggccgtgatcaag gaactggcctgcgaagccttcgagatcgagcccgatgagctggccgagcacacgctgttc gacgaggacctcggcatcgactcgctgagcgcgatcgacctgctcgccgcgctggagaag cgcttcggcgtggagatcgaccaggtggacctgtcccagctgaccagcctggccacggtc tacgagttcatcgccggggaactgggctggaccggcggcggggtcgccgccgggcagccg gtctccggtgtggtgagcggggcttga

DBGET integrated database retrieval system