Amycolatopsis sp. YIM 10: YIM_26890 Help Entry YIM_26890         CDS       T06270                                  Symbol acpP3 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism amyy  Amycolatopsis sp. YIM 10 Pathway amyy00998   Biosynthesis of various antibiotics amyy01100   Metabolic pathways amyy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amyy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     YIM_26890 (acpP3)    00074 Mycolic acid biosynthesis     YIM_26890 (acpP3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     YIM_26890 (acpP3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QFU90552 LinkDB All DBs Position complement(5624337..5624600) Genome browser AA seq 87 aa AA seqDB search MLETDNALGGERERRVKEIVCEILEIDPAEVTEESLFKEDHDADSLRAIEILAALERNFG IVIDQAELSRMVNLAGVHEVVAEASAR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgctcgagacggacaacgcgctcggtggcgagcgcgagcggagggtcaaggagatcgtc tgcgagatcctggaaatcgacccggccgaggtgaccgaggaaagcctgttcaaagaggac cacgacgcggactcgctgcgggcgatcgagatcctcgccgcgctggaacggaacttcggg atcgtcatcgaccaggcggagctgagccggatggtgaatctcgccggggtgcacgaggtg gtcgccgaggcctccgcgcgatga

DBGET integrated database retrieval system