Amycolatopsis mediterranei RB: B737_3587 Help Entry B737_3587         CDS       T02804                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amz  Amycolatopsis mediterranei RB Pathway amz00998   Biosynthesis of various antibiotics amz01100   Metabolic pathways amz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B737_3587 (acpP)    00074 Mycolic acid biosynthesis     B737_3587 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B737_3587 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GRHL1_C DIMCO_N Motif Other DBs NCBI-ProteinID:  AGT84251 LinkDB All DBs Position complement(3941818..3942075) Genome browser AA seq 85 aa AA seqDB search MEHVKIVSAIEQALTDVLQRPVSGMAEETRLFDDLHLDSTSVLELLMALEDTVGIEVDPE SLEVSDFKTIGTLAGYVSDNLDRVS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaacacgtgaagatcgtctccgcgatcgaacaggcgctcaccgacgtcctgcagcgc ccggtctccggcatggccgaggagacccggctcttcgacgacctgcacctggactcgaca tcggtgctggagctgctgatggcgctggaggacacggtcggcatcgaggtggacccggag agcctcgaggtctccgacttcaagaccatcgggaccctcgccggctacgtctcggacaac ctcgaccgcgtctcctga

DBGET integrated database retrieval system