Aotus nancymaae (Ma's night monkey): 105704699 Help Entry 105704699         CDS       T10127                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04022   cGMP-PKG signaling pathway anan04081   Hormone signaling anan04270   Vascular smooth muscle contraction anan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:anan00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     105704699 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     105704699 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     105704699 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105704699 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:anan04052]     105704699 (NPPC) Cytokines and neuropeptides [BR:anan04052]  Neuropeptides   Unclassified    105704699 (NPPC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  105704699 NCBI-ProteinID:  XP_012289465 Ensembl:  ENSANAG00000034399 UniProt:  A0A2K5EJQ3 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAQSKVPRTPPGEELAEPQAAGGCQKKGDKAPGGG GANLKGDRSRLLRDLRADTKSRAAWGRHVQEHPNARKHKASNKKNLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctgctctcactccggccc tctgaagccaagcccggggcgcagtcgaaggtcccgcgaaccccgccgggagaggagctg gcggagccccaggctgcgggcggctgtcagaagaagggcgacaaggctccagggggcggg ggcgccaacctcaagggcgatcggtcgcgactgctccgggacctgcgcgcggacaccaag tcgcgggcagcgtggggccgccatgtgcaggagcaccccaacgcgcgcaaacacaaagca tccaacaagaagaacttgtccaagggctgcttcggcctcaagctggaccgaatcggctcc atgagcggcctgggatgttag

DBGET integrated database retrieval system