Aotus nancymaae (Ma's night monkey): 105704916 Help Entry 105704916         CDS       T10127                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04010   MAPK signaling pathway anan04060   Cytokine-cytokine receptor interaction anan04217   Necroptosis anan04218   Cellular senescence anan04380   Osteoclast differentiation anan04640   Hematopoietic cell lineage anan04932   Non-alcoholic fatty liver disease anan04933   AGE-RAGE signaling pathway in diabetic complications anan04940   Type I diabetes mellitus anan05010   Alzheimer disease anan05020   Prion disease anan05022   Pathways of neurodegeneration - multiple diseases anan05133   Pertussis anan05140   Leishmaniasis anan05152   Tuberculosis anan05162   Measles anan05164   Influenza A anan05321   Inflammatory bowel disease anan05323   Rheumatoid arthritis anan05332   Graft-versus-host disease anan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:anan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105704916 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105704916 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105704916 (IL1A)    04218 Cellular senescence     105704916 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105704916 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     105704916 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     105704916 (IL1A)    05162 Measles     105704916 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     105704916 (IL1A)    05152 Tuberculosis     105704916 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105704916 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     105704916 (IL1A)    05321 Inflammatory bowel disease     105704916 (IL1A)    05332 Graft-versus-host disease     105704916 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     105704916 (IL1A)    05020 Prion disease     105704916 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     105704916 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105704916 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     105704916 (IL1A)    04932 Non-alcoholic fatty liver disease     105704916 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     105704916 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:anan04052]     105704916 (IL1A) Cytokines and neuropeptides [BR:anan04052]  Cytokines   Interleukins    105704916 (IL1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1_propep IL1 HrcA Motif Other DBs NCBI-GeneID:  105704916 NCBI-ProteinID:  XP_064233879 LinkDB All DBs Position Unknown AA seq 271 aa AA seqDB search MAKVPDMFEDLKNCYSENEEYSSSIDHLSLNQKSFYDVNYGSLHEECMDQSVSLNISETS KTSKFTFKESVVIVSTNGKVLKKRRLTLNQSITDDDLEAIANDIEEEIIKPRSAPFSFLS NAKYNFNKTRKHQFILNVALNHQSIIQTNDQHLMTTALQNLDEAAKFDMDAYISSKDDKD YVTLRISKTRLYVSAQDENQPVLLKEMPEIPKTITGSEINLLFFWETQGTKSYFRSVAHP DLLIATVQDSLVCLARGPPFITDFQILENQT NT seq 816 nt NT seq  +upstreamnt  +downstreamnt atggccaaagttccagatatgtttgaagatctgaagaactgttacagtgaaaatgaagag tacagttcctccattgaccatctgtctctgaatcaaaaatccttctatgatgtaaactat ggctcactccatgaagaatgcatggatcaatctgtgtctctgaatatctctgaaacctct aagacatccaagtttaccttcaaggagagtgtggtgatagtgtcgaccaacgggaaggtt ctgaagaagagacggttgactttaaaccaatccatcactgatgatgacctggaggccatc gccaatgacatagaagaagaaatcatcaagcccaggtcagcacctttcagcttcctgagc aatgcaaaatacaactttaataagaccaggaaacaccaattcatcctgaatgtcgccctc aatcatcaaagtataattcaaaccaacgatcagcacctcatgactactgcattacaaaat ctggatgaagcagcgaaatttgacatggatgcttatatatcatcaaaggatgacaaagat tatgtgactctaagaatctcaaaaactcgactgtatgtgagtgcccaagatgaaaaccaa ccggtgttgctgaaggagatgcctgaaatacccaaaaccatcacaggtagtgagatcaac ctcctcttcttctgggaaactcaaggaactaagagctacttcagatcagttgcccatcca gatttgcttattgccacagtgcaagacagtttggtgtgcttggcaaggggaccacccttt atcactgactttcagatactggaaaaccagacttag

DBGET integrated database retrieval system