Aotus nancymaae (Ma's night monkey): 105705461 Help Entry 105705461         CDS       T10127                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04137   Mitophagy - animal anan04140   Autophagy - animal anan04144   Endocytosis anan04145   Phagosome anan04148   Efferocytosis anan05132   Salmonella infection anan05146   Amoebiasis anan05152   Tuberculosis Brite KEGG Orthology (KO) [BR:anan00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105705461 (RAB7A)    04145 Phagosome     105705461 (RAB7A)    04140 Autophagy - animal     105705461 (RAB7A)    04137 Mitophagy - animal     105705461 (RAB7A)    04148 Efferocytosis     105705461 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105705461 (RAB7A)    05152 Tuberculosis     105705461 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     105705461 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:anan04131]     105705461 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:anan04147]     105705461 (RAB7A)    04031 GTP-binding proteins [BR:anan04031]     105705461 (RAB7A) Membrane trafficking [BR:anan04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     105705461 (RAB7A) Exosome [BR:anan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105705461 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    105705461 (RAB7A)   Exosomal proteins of colorectal cancer cells    105705461 (RAB7A)   Exosomal proteins of bladder cancer cells    105705461 (RAB7A) GTP-binding proteins [BR:anan04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     105705461 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  105705461 NCBI-ProteinID:  XP_012290803 Ensembl:  ENSANAG00000029692 UniProt:  A0A2K5DSN8 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagtcggg aagacatcactcatgaaccagtatgtgaataagaaattcagcaatcagtacaaagccaca ataggagctgactttctcaccaaggaggtgatggtggatgacagactagtcacaatgcag atttgggacacagcaggacaggaacggttccagtctcttggtgtggccttctacagaggc gcagactgctgcgttctggtatttgacgtgactgcccccaacacattcaaaaccctagat agctggagagatgagtttctcatccaggccagtccccgagatcctgaaaacttccccttc gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctactttgagaccagtgccaaggaggccatc aacgtggagcaggcgttccagacgattgcacggaatgcacttaagcaggaaacagaggtg gagctgtacaacgaattccccgaacctatcaaactggacaagaatgaccgggccaaggcc tccgcagaaagctgcagttgctga

DBGET integrated database retrieval system