KEGG   Aotus nancymaae (Ma's night monkey): 105706857
Entry
105706857         CDS       T10127                                 
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7 isoform X1
  KO
K03038  26S proteasome regulatory subunit N8
Organism
anan  Aotus nancymaae (Ma's night monkey)
Pathway
anan03050  Proteasome
anan05010  Alzheimer disease
anan05012  Parkinson disease
anan05014  Amyotrophic lateral sclerosis
anan05016  Huntington disease
anan05017  Spinocerebellar ataxia
anan05020  Prion disease
anan05022  Pathways of neurodegeneration - multiple diseases
anan05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:anan00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    105706857 (PSMD7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    105706857 (PSMD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105706857 (PSMD7)
   05012 Parkinson disease
    105706857 (PSMD7)
   05014 Amyotrophic lateral sclerosis
    105706857 (PSMD7)
   05016 Huntington disease
    105706857 (PSMD7)
   05017 Spinocerebellar ataxia
    105706857 (PSMD7)
   05020 Prion disease
    105706857 (PSMD7)
   05022 Pathways of neurodegeneration - multiple diseases
    105706857 (PSMD7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:anan03051]
    105706857 (PSMD7)
Proteasome [BR:anan03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     105706857 (PSMD7)
SSDB
Motif
Pfam: MitMem_reg JAB Connexin Coilin_N
Other DBs
NCBI-GeneID: 105706857
NCBI-ProteinID: XP_012292916
Ensembl: ENSANAG00000034238
UniProt: A0A2K5EIV5
LinkDB
Position
Unknown
AA seq 324 aa
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
KEDKEKDKDKEKSDGKKEEKKEKK
NT seq 975 nt   +upstreamnt  +downstreamnt
atgccggagctggcggtgcagaaggtggtggtccaccccctggtgctgcttagtgtggtg
gatcatttcaaccgaattggcaaggttggaaaccagaagcgtgttgttggtgtgcttttg
ggatcatggcagaagaaagtactggatgtatcgaacagttttgcagttccttttgatgaa
gatgacaaagacgattctgtgtggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaagtcaatgccagagaaagaatagttggctggtaccacacgggcccgaaa
ctacacaagaatgacattgccatcaacgaactcatgaaaagatactgtcctaattccgta
ttggtcattattgacgtgaagccaaaggacctggggctgcccacagaagcatacatttca
gtggaagaagtccatgatgatggaactccaacctcaaaaacatttgaacacgtcaccagt
gaaattggagcagaggaagctgaggaagttggagttgaacacttgttacgagacatcaaa
gacacaacagtgggcactctgtcccagcggatcacaaaccaggtccatggtttgaaggga
ctgaactccaagcttctggatatcaggagctacctggaaaaagttgccacaggaaagctg
cccatcaaccaccagatcatctaccagctgcaggacgtcttcaacctgctgccagacgtc
agcctgcaggagtttgtcaaagccttttacctgaagaccaacgaccagatggtggtggtg
tacctggcctcgctgatccgttccgtggttgccctgcacaacctcatcaacaacaagatt
gccaaccgggatgcagagaagaaagaagggcaggagaaagaagaaagcaaaaaggatagg
aaagaggacaaggagaaagataaagataaggaaaagagtgatggaaagaaagaggagaaa
aaggagaaaaagtaa

DBGET integrated database retrieval system