Aotus nancymaae (Ma's night monkey): 105709929 Help Entry 105709929         CDS       T10127                                  Name (RefSeq) cofilin-1-like   KO K05765   cofilin Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04360   Axon guidance anan04666   Fc gamma R-mediated phagocytosis anan04810   Regulation of actin cytoskeleton anan05133   Pertussis anan05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:anan00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105709929  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     105709929   09158 Development and regeneration    04360 Axon guidance     105709929  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105709929   09171 Infectious disease: bacterial    05133 Pertussis     105709929  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:anan04131]     105709929   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:anan04812]     105709929    04147 Exosome [BR:anan04147]     105709929 Membrane trafficking [BR:anan04131]  Others   Actin-binding proteins    Others     105709929 Cytoskeleton proteins [BR:anan04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      105709929 Exosome [BR:anan04147]  Exosomal proteins   Proteins found in most exosomes    105709929 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  105709929 NCBI-ProteinID:  XP_064226607 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFKDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYTTFVKMLPDKDCCYALYDATYKTKESKKEDLVFIFWAPKSAPFKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDHCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctgtctccgatggagtcatcaaggtgttcaaagacatgaaggtg cgtaagtcttcaacgccagaggaggtgaagaagcgcaagaaggctgtgctcttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggcgatgtg ggccaaactgtcgatgacccctacaccacctttgtcaagatgctgccggataaggactgt tgctatgccctttatgatgcaacctacaagaccaaggagagcaagaaggaggacctggtg tttatcttctgggctcctaagtctgcgccctttaaaagcaaaatgatctatgccagctcc aaggacgccatcaagaagaagctgacggggatcaagcatgaattgcaagcaaactgctat gaagaggtcaaggaccactgcaccctggcagagaagctggggggcagtgccgtcatctcc ctggagggtaagcctttgtga

DBGET integrated database retrieval system