Aotus nancymaae (Ma's night monkey): 105711866 Help Entry 105711866         CDS       T10127                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism anan  Aotus nancymaae (Ma's night monkey) Brite KEGG Orthology (KO) [BR:anan00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:anan01002]     105711866 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:anan04147]     105711866 (CSTB) Peptidases and inhibitors [BR:anan01002]  Peptidase inhibitors   Family I25: cystatin family    105711866 (CSTB) Exosome [BR:anan04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    105711866 (CSTB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Dynein_light SQAPI Motif Other DBs NCBI-GeneID:  105711866 NCBI-ProteinID:  XP_012300207 Ensembl:  ENSANAG00000038089 UniProt:  A0A2K5F7Y5 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MMCGAPSAAQPATAETQNIADQVRSQLEEKENKKFPVFKAVSFRSQVVAGTNYFIKVHVG DDEFVHLRVFQSLPHENKPLTLSDYQTNKAKHDELSYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggggcgccctccgccgcgcagccggccaccgccgagacccagaacatcgcc gaccaggtgagatcccagcttgaagaaaaagaaaacaagaagttccccgtgtttaaggct gtgtccttcaggagccaggtggttgcggggacgaactacttcatcaaggtgcatgtcggt gacgacgaatttgtccacttgcgagtattccaaagtctccctcacgaaaacaagcccctg accttgtctgactaccagaccaacaaagccaagcacgatgagctgtcctatttctga

DBGET integrated database retrieval system