Aotus nancymaae (Ma's night monkey): 105713052 Help Entry 105713052         CDS       T10127                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04146   Peroxisome anan04213   Longevity regulating pathway - multiple species anan05012   Parkinson disease anan05014   Amyotrophic lateral sclerosis anan05016   Huntington disease anan05020   Prion disease anan05022   Pathways of neurodegeneration - multiple diseases anan05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:anan00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     105713052 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     105713052 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     105713052 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     105713052 (SOD1)    05014 Amyotrophic lateral sclerosis     105713052 (SOD1)    05016 Huntington disease     105713052 (SOD1)    05020 Prion disease     105713052 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     105713052 (SOD1) Enzymes [BR:anan01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      105713052 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  105713052 NCBI-ProteinID:  XP_012301979 UniProt:  A0A2K5F922 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MKAVCVLKGDGPVQGTINFEQKESNGPVKVWGSITGLAEGLHGFHVHQFGDNTQGCTSAG PHFNPLSRKHGGPEDEERHVGDLGNVTAGKDGVANVSIEDSVISLSGDHSIIGRTLVVHE KADDLGKGGNEESTKTGNAGSRLACGVIGIAQ NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgaaggcggtgtgcgtgttgaagggcgacggcccggtgcagggcaccatcaatttcgag cagaaggaaagtaatggaccagttaaggtgtggggaagcattacaggattggctgaaggc ctgcatggattccatgttcatcagtttggagataatacgcaaggctgtaccagtgcaggt cctcactttaatcctctatccagaaaacatggtgggccagaggatgaagagaggcatgtt ggagacctgggcaatgtgactgctggtaaagatggtgtggccaatgtgtcaattgaagac tctgtgatctcactctcaggagaccattccatcattggccgcacgttggtggtccacgaa aaagcagatgacttgggcaaaggtggaaatgaagaaagtacaaagacaggaaacgctgga agtcgtctggcttgtggtgtcattgggatcgcccagtaa

DBGET integrated database retrieval system