Aotus nancymaae (Ma's night monkey): 105714253 Help Entry 105714253         CDS       T10127                                  Name (RefSeq) profilin-1-like   KO K05759   profilin Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04015   Rap1 signaling pathway anan04810   Regulation of actin cytoskeleton anan05014   Amyotrophic lateral sclerosis anan05132   Salmonella infection Brite KEGG Orthology (KO) [BR:anan00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105714253  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105714253  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105714253   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105714253  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:anan04131]     105714253   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:anan04812]     105714253    04147 Exosome [BR:anan04147]     105714253 Membrane trafficking [BR:anan04131]  Others   Actin-binding proteins    Others     105714253 Cytoskeleton proteins [BR:anan04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105714253 Exosome [BR:anan04147]  Exosomal proteins   Proteins found in most exosomes    105714253 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105714253 NCBI-ProteinID:  XP_064222347 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGSCQDVAIVGYKDSPSVWATVPGKTFVNITPAEVGVLVGKDRSSFY VNGLTLGGQKCSVIQDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH GGLIKKKCYEMASHLRSAQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctatatcgacaacctcatggcggacgggagctgtcaggacgtg gccatcgtgggctacaaggactcgccctccgtctgggccactgtccctgggaaaaccttc gtcaacatcacgccagctgaagttggtgtcctggttggcaaagaccggtcaagtttttac gtgaatgggctgacacttgggggccagaaatgttcggttatccaggactcactgctgcag gatggggaatttagcatggatcttcgtaccaagagcaccggtggagcccccaccttcaat gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtttgatcaagaagaaatgttatgaaatggcctcccaccttcggagtgcccagtac tga

DBGET integrated database retrieval system