Aotus nancymaae (Ma's night monkey): 105714290 Help Entry 105714290         CDS       T10127                                  Name (RefSeq) claudin-7-like   KO K06087   claudin Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan03272   Virion - Hepatitis viruses anan04382   Cornified envelope formation anan04514   Cell adhesion molecule (CAM) interaction anan04530   Tight junction anan04670   Leukocyte transendothelial migration anan05160   Hepatitis C Brite KEGG Orthology (KO) [BR:anan00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     105714290  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     105714290  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     105714290  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     105714290   09158 Development and regeneration    04382 Cornified envelope formation     105714290  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     105714290  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:anan03037]     105714290    04147 Exosome [BR:anan04147]     105714290 Cilium and associated proteins [BR:anan03037]  Other cilia and associated proteins   Stereociliary proteins    105714290 Exosome [BR:anan04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    105714290   Exosomal proteins of colorectal cancer cells    105714290 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Motif Other DBs NCBI-GeneID:  105714290 NCBI-ProteinID:  XP_064220710 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MEVANLGLQLLNFSMALLGWVGPVACTAILQWQISSCVGNSIITAQAMYKGLWMNYIMQT MGLMSCEIYDLVLTLPAAMQAPQALMMASLVLGFLTMCVATMGMECMCCGESDKVKNARI VDMVGVIFIMAGMSLFLLSLLAGQGLLWPS NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atggaagtggccaatttgggcttgcagttgctgaacttttccatggctttgctgggctgg gtgggccctgtggcctgtaccgccatcctgcagtggcagataagctcatgtgtgggcaac agcatcatcacagcccaggccatgtacaagggactgtggatgaactacatcatgcagacc atgggcttgatgagctgtgaaatatatgacttggtgctcaccctgccagcagccatgcag gcccctcaagccctaatgatggcatcccttgtgctgggcttcctgaccatgtgtgtggcc acaatgggcatggagtgcatgtgctgtggggaaagtgacaaagtgaagaatgcccgtata gttgatatggttggtgtcattttcatcatggcaggtatgagtttgttcctgctatcttta ctggctgggcagggtcttctctggccctcctag

DBGET integrated database retrieval system