Aotus nancymaae (Ma's night monkey): 105714378 Help Entry 105714378         CDS       T10127                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04066   HIF-1 signaling pathway anan04120   Ubiquitin mediated proteolysis anan05170   Human immunodeficiency virus 1 infection anan05200   Pathways in cancer anan05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:anan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105714378  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     105714378  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105714378   09162 Cancer: specific types    05211 Renal cell carcinoma     105714378   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105714378  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:anan04121]     105714378    03400 DNA repair and recombination proteins [BR:anan03400]     105714378 Ubiquitin system [BR:anan04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      105714378    Cul5 complex      105714378 DNA repair and recombination proteins [BR:anan03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      105714378 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  105714378 NCBI-ProteinID:  XP_064234180 Ensembl:  ENSANAG00000019545 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MDGEEKTCGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaggagaaaacctgtggtggctgtgaaggccctgatgccatgtatgtcaaa ttgatatcatctgatggccatgaatttattgtaaaaagagaacatgcattaacatcaggc acaataaaagccatgttgagtggcccaggtcaatttgctgagaatgaaaccaatgaggtc aattttagagagataccttcacatgtgctatcaaaagtatgcatgtattttacgtacaag gttcgctacactaacagctccactgagattcctgaattcccaattgcacctgaaattgca ctagaactgctgatggctgcgaacttcctagattgttga

DBGET integrated database retrieval system