Aotus nancymaae (Ma's night monkey): 105715624 Help Entry 105715624         CDS       T10127                                  Symbol IFNA21 Name (RefSeq) interferon alpha-21   KO K05414   interferon alpha Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04060   Cytokine-cytokine receptor interaction anan04151   PI3K-Akt signaling pathway anan04217   Necroptosis anan04620   Toll-like receptor signaling pathway anan04621   NOD-like receptor signaling pathway anan04622   RIG-I-like receptor signaling pathway anan04623   Cytosolic DNA-sensing pathway anan04630   JAK-STAT signaling pathway anan04650   Natural killer cell mediated cytotoxicity anan04936   Alcoholic liver disease anan05152   Tuberculosis anan05160   Hepatitis C anan05161   Hepatitis B anan05162   Measles anan05163   Human cytomegalovirus infection anan05164   Influenza A anan05165   Human papillomavirus infection anan05167   Kaposi sarcoma-associated herpesvirus infection anan05168   Herpes simplex virus 1 infection anan05169   Epstein-Barr virus infection anan05170   Human immunodeficiency virus 1 infection anan05171   Coronavirus disease - COVID-19 anan05200   Pathways in cancer anan05320   Autoimmune thyroid disease anan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:anan00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105715624 (IFNA21)    04151 PI3K-Akt signaling pathway     105715624 (IFNA21)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105715624 (IFNA21)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105715624 (IFNA21)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105715624 (IFNA21)    04621 NOD-like receptor signaling pathway     105715624 (IFNA21)    04622 RIG-I-like receptor signaling pathway     105715624 (IFNA21)    04623 Cytosolic DNA-sensing pathway     105715624 (IFNA21)    04650 Natural killer cell mediated cytotoxicity     105715624 (IFNA21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105715624 (IFNA21)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105715624 (IFNA21)    05161 Hepatitis B     105715624 (IFNA21)    05160 Hepatitis C     105715624 (IFNA21)    05171 Coronavirus disease - COVID-19     105715624 (IFNA21)    05164 Influenza A     105715624 (IFNA21)    05162 Measles     105715624 (IFNA21)    05168 Herpes simplex virus 1 infection     105715624 (IFNA21)    05163 Human cytomegalovirus infection     105715624 (IFNA21)    05167 Kaposi sarcoma-associated herpesvirus infection     105715624 (IFNA21)    05169 Epstein-Barr virus infection     105715624 (IFNA21)    05165 Human papillomavirus infection     105715624 (IFNA21)   09171 Infectious disease: bacterial    05152 Tuberculosis     105715624 (IFNA21)   09163 Immune disease    05320 Autoimmune thyroid disease     105715624 (IFNA21)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105715624 (IFNA21)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105715624 (IFNA21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:anan04052]     105715624 (IFNA21) Cytokines and neuropeptides [BR:anan04052]  Cytokines   Interferons    105715624 (IFNA21) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon iSTAND Motif Other DBs NCBI-GeneID:  105715624 NCBI-ProteinID:  XP_012305454 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MALSFSLLMAMVVLSCKSICSLGCDLPQTHSLGNRRVLILLAQMGRISPFSCLKDRNDFE FPQEEFDSNQFQKAQAISVLHEMIQQTFNLFSTKASSAAWEQSLLEKFSNELYQQLNDLE ACVIQEVGVEETPLMNADSILAVRKYFQRITLYLTKKKYSPCSWEVVRAEIMRSFSLSTN LQEKLRRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgtccttttctttactgatggccatggtggtgctcagctgcaaatccatctgc tctcttggctgtgatctgcctcagacccacagcctgggtaacaggagggtcttgatactc ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagaaatgactttgaa ttcccccaagaggagtttgatagcaaccagttccagaaggctcaagccatctctgtcctc catgagatgatacagcagaccttcaatctcttcagcacaaaagcctcatctgctgcttgg gaacagagccttctagagaaattttccaatgaactctaccagcagctgaatgatctggaa gcctgtgtaatacaggaggttggggtggaagagactcccctgatgaatgcagattccatc ctggctgtgcggaaatactttcaaagaattactctttatctgacaaagaaaaaatacagc ccttgttcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaacaaac ttgcaagaaaaattaaggaggaaggaatga

DBGET integrated database retrieval system