Aotus nancymaae (Ma's night monkey): 105716213 Help Entry 105716213         CDS       T10127                                  Symbol IL3 Name (RefSeq) interleukin-3   KO K04736   interleukin 3 Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04060   Cytokine-cytokine receptor interaction anan04151   PI3K-Akt signaling pathway anan04210   Apoptosis anan04630   JAK-STAT signaling pathway anan04640   Hematopoietic cell lineage anan04664   Fc epsilon RI signaling pathway anan05200   Pathways in cancer anan05202   Transcriptional misregulation in cancer anan05221   Acute myeloid leukemia anan05310   Asthma Brite KEGG Orthology (KO) [BR:anan00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105716213 (IL3)    04151 PI3K-Akt signaling pathway     105716213 (IL3)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105716213 (IL3)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105716213 (IL3)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105716213 (IL3)    04664 Fc epsilon RI signaling pathway     105716213 (IL3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105716213 (IL3)    05202 Transcriptional misregulation in cancer     105716213 (IL3)   09162 Cancer: specific types    05221 Acute myeloid leukemia     105716213 (IL3)   09163 Immune disease    05310 Asthma     105716213 (IL3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:anan04052]     105716213 (IL3)    00536 Glycosaminoglycan binding proteins [BR:anan00536]     105716213 (IL3) Cytokines and neuropeptides [BR:anan04052]  Cytokines   Interleukins    105716213 (IL3) Glycosaminoglycan binding proteins [BR:anan00536]  Heparan sulfate / Heparin   Cytokines    105716213 (IL3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL3 Sec3_CC Motif Other DBs NCBI-GeneID:  105716213 NCBI-ProteinID:  XP_012306236 Ensembl:  ENSANAG00000036943 UniProt:  A0A2K5F0R8 LinkDB All DBs Position Unknown AA seq 143 aa AA seqDB search MSHLPILLLLLLLVSPRLQAAPTQTTPLKTTQVNCSNLREEIVTLLNQPPLPSSNFNNLN REDQRILMKPNLRRPNLEAFQKAVKSLQNATAIESNLKDLPLCLPTATDAPTQHPIRIKN GDWNDFRMKLKFYLKTLEIKKPQ NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgagccacctgcccatcctgctcctcctcctactcctggtcagccccagacttcaagct gccccaacccagacaacgcccttgaagacaactcaggttaactgctctaacttgagggag gaaattgtaacactcctaaaccagccacctttgccttcatcaaacttcaacaacttaaac agggaagaccaacgcattctgatgaaaccaaaccttcgaaggccaaacctggaagcattc cagaaggccgtcaagagtttacagaacgcaacagcaatcgagagcaatcttaaggatctc ccactatgcctgcccacagccacagatgcacccacgcaacatccaatccgtatcaagaac ggtgactggaatgacttccggatgaaactgaagttctatttgaaaacccttgagattaag aagcctcaatag

DBGET integrated database retrieval system