Aotus nancymaae (Ma's night monkey): 105717237 Help Entry 105717237         CDS       T10127                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan00190   Oxidative phosphorylation anan01100   Metabolic pathways anan01524   Platinum drug resistance anan04115   p53 signaling pathway anan04210   Apoptosis anan04215   Apoptosis - multiple species anan04932   Non-alcoholic fatty liver disease anan05010   Alzheimer disease anan05012   Parkinson disease anan05014   Amyotrophic lateral sclerosis anan05016   Huntington disease anan05017   Spinocerebellar ataxia anan05020   Prion disease anan05022   Pathways of neurodegeneration - multiple diseases anan05132   Salmonella infection anan05134   Legionellosis anan05145   Toxoplasmosis anan05152   Tuberculosis anan05160   Hepatitis C anan05161   Hepatitis B anan05162   Measles anan05163   Human cytomegalovirus infection anan05164   Influenza A anan05167   Kaposi sarcoma-associated herpesvirus infection anan05168   Herpes simplex virus 1 infection anan05169   Epstein-Barr virus infection anan05170   Human immunodeficiency virus 1 infection anan05200   Pathways in cancer anan05210   Colorectal cancer anan05222   Small cell lung cancer anan05416   Viral myocarditis anan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:anan00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     105717237  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105717237    04215 Apoptosis - multiple species     105717237    04115 p53 signaling pathway     105717237  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105717237   09162 Cancer: specific types    05210 Colorectal cancer     105717237    05222 Small cell lung cancer     105717237   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105717237    05161 Hepatitis B     105717237    05160 Hepatitis C     105717237    05164 Influenza A     105717237    05162 Measles     105717237    05168 Herpes simplex virus 1 infection     105717237    05163 Human cytomegalovirus infection     105717237    05167 Kaposi sarcoma-associated herpesvirus infection     105717237    05169 Epstein-Barr virus infection     105717237   09171 Infectious disease: bacterial    05132 Salmonella infection     105717237    05134 Legionellosis     105717237    05152 Tuberculosis     105717237   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105717237   09164 Neurodegenerative disease    05010 Alzheimer disease     105717237    05012 Parkinson disease     105717237    05014 Amyotrophic lateral sclerosis     105717237    05016 Huntington disease     105717237    05017 Spinocerebellar ataxia     105717237    05020 Prion disease     105717237    05022 Pathways of neurodegeneration - multiple diseases     105717237   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105717237    05416 Viral myocarditis     105717237   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105717237   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     105717237 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Motif Other DBs NCBI-GeneID:  105717237 NCBI-ProteinID:  XP_012307687 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKSKKFFFQKCAQCHIIEKGGKHKTGPNLHGLLGQKTGQSLGFSYTDANKNKGITW GKDTLKKYWDNPKKCIPGTKMIFAGIKKKVERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaagcaagaagtttttttttcagaagtgtgcccagtgccacatc attgaaaagggaggcaagcacaagactgggcctaatctccatggtctccttgggcagaag acaggtcagtcccttggattctcttacacagatgccaataagaacaaaggcatcacatgg ggaaaggatacattgaagaagtattgggacaatcccaagaagtgtatccctggaacaaaa atgatctttgctggcattaagaagaaagtggaaagggcagacttgatagcttatctcaaa aaagctactaatgagtaa

DBGET integrated database retrieval system