Aotus nancymaae (Ma's night monkey): 105721149 Help Entry 105721149         CDS       T10127                                  Symbol URM1 Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:anan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     105721149 (URM1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:anan03016]     105721149 (URM1)    04121 Ubiquitin system [BR:anan04121]     105721149 (URM1) Transfer RNA biogenesis [BR:anan03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     105721149 (URM1) Ubiquitin system [BR:anan04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    105721149 (URM1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  105721149 NCBI-ProteinID:  XP_012313450 Ensembl:  ENSANAG00000036717 UniProt:  A0A2K5EZG7 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MAAPLSVEVEFGGGAELLFDGIKKHQVTLPGQEEPWDIRNLLVWIKKNLLKERPELFIQG DSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcagcgcccttgtcagtggaggtggagttcggaggcggtgcggaactcctgtttgat ggtattaagaaacatcaagtcactttgcctggacaggaggaaccctgggacatccggaac ctgctcgtctggatcaagaagaatttgctaaaagagcggccagagttgttcatccaggga gacagcgtgcggccaggaattctggtgctgattaatgatgccgactgggagctactgggt gagctggactatcaacttcaggaccaggacagtgtcctcttcatctccactctgcatggc ggctga

DBGET integrated database retrieval system