Aotus nancymaae (Ma's night monkey): 105721498 Help Entry 105721498         CDS       T10127                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04613   Neutrophil extracellular trap formation anan05034   Alcoholism anan05202   Transcriptional misregulation in cancer anan05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:anan00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105721498  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105721498   09163 Immune disease    05322 Systemic lupus erythematosus     105721498   09165 Substance dependence    05034 Alcoholism     105721498  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:anan03036]     105721498   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:anan04147]     105721498 Chromosome and associated proteins [BR:anan03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105721498 Exosome [BR:anan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105721498 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  105721498 NCBI-ProteinID:  XP_021523308 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcactaagcaaactgctcggaagtctacgggcggcaaggctccgcgcaaacag ctggccaccaaggcggcccgcaagagcgctccggctaccggtggcgtgaaaaagcctcat cggtaccgccccggcaccgtggctttgcgcgagatccgccgttatcagaagtccacagag ctgctgattcgtaaactccctttccagcgcctggtgcgcgagattgcgcaggactttaaa acggacctgcgtttccagagttccgctgtgatggctctgcaggaggcgtgtgaggcctac ttggtggggctgtttgaggacaccaatctgtgcgccatccacgccaagcgcgttactatt atgcccaaggacatccagctcgctcgccgcatccgtggagagcgggcgtga

DBGET integrated database retrieval system