Aotus nancymaae (Ma's night monkey): 105721509 Help Entry 105721509         CDS       T10127                                  Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04613   Neutrophil extracellular trap formation anan05034   Alcoholism anan05203   Viral carcinogenesis anan05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:anan00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105721509  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105721509   09163 Immune disease    05322 Systemic lupus erythematosus     105721509   09165 Substance dependence    05034 Alcoholism     105721509  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:anan03036]     105721509   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:anan04147]     105721509 Chromosome and associated proteins [BR:anan03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105721509 Exosome [BR:anan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105721509 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  105721509 NCBI-ProteinID:  XP_012314008 UniProt:  A0A2K5C3J0 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagctaagtcagctcctgctccaaaaaaagggtccaagaaggcggtaact aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgta tatgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcctccaaagccatg ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcttcccgc ctggcgcattacaacaagcgctcgaccatcacttccagggagatccagacggccgtgcgc ctgctgcttcccggggagctggccaagcacgccgtgtcggagggcaccaaggccgtcacc aagtataccagctccaagtaa

DBGET integrated database retrieval system